Protein Info for GFF525 in Sphingobium sp. HT1-2

Annotation: Benzoate transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 9 to 34 (26 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 208 to 233 (26 residues), see Phobius details amino acids 251 to 274 (24 residues), see Phobius details amino acids 288 to 313 (26 residues), see Phobius details amino acids 319 to 340 (22 residues), see Phobius details amino acids 349 to 380 (32 residues), see Phobius details TIGR00843: benzoate transporter" amino acids 9 to 378 (370 residues), 376.3 bits, see alignment E=8.5e-117 PF03594: BenE" amino acids 9 to 380 (372 residues), 453.7 bits, see alignment E=2.4e-140

Best Hits

KEGG orthology group: K05782, benzoate membrane transport protein (inferred from 58% identity to psa:PST_1675)

Predicted SEED Role

"Benzoate transport protein" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>GFF525 Benzoate transport protein (Sphingobium sp. HT1-2)
MTASQTGWIPAIIAGIIATTISYAGPLVIIFQAAQGLEPALVASWIWAISIGSGLLGILL
SWRWRVPIVIAWSAPGSALLVTMLPQTDFATAIGAYIVANLAVLLVGLSGAFDRLMQRLP
AAITAAMLAGILFRFVIDMIGAVPSAPVMLIAMIAAFFAGRVLAPRYAVVAVLITGVAIT
ALSGGLSGSIGTPHLTMPVWTTPRFDWAATASIAVPLAVVALTGQFLPGIAILRAAGYDQ
PAARPIVSTSAIASIALAPFGCHGLNLAAFTAAICLGPDAHPDPARRYMAGIAGGVTYLV
FGAFAATVLALFATLPKTLIAALAGLALFPVVANSLSTALRAEQGRDAALVTFAVSASGM
TLAGLGSAFWGLIFGLAVHLLQSAITKQPDQATA