Protein Info for PS417_26860 in Pseudomonas simiae WCS417

Annotation: phosphopantetheine adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 TIGR00125: cytidyltransferase-like domain" amino acids 3 to 63 (61 residues), 69.3 bits, see alignment E=2.5e-23 TIGR01510: pantetheine-phosphate adenylyltransferase" amino acids 4 to 154 (151 residues), 195.6 bits, see alignment E=5e-62 PF01467: CTP_transf_like" amino acids 5 to 133 (129 residues), 110.2 bits, see alignment E=9e-36 PF08218: Citrate_ly_lig" amino acids 11 to 110 (100 residues), 28.7 bits, see alignment E=1.1e-10

Best Hits

Swiss-Prot: 100% identical to COAD_PSEF5: Phosphopantetheine adenylyltransferase (coaD) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K00954, pantetheine-phosphate adenylyltransferase [EC: 2.7.7.3] (inferred from 94% identity to pmy:Pmen_4191)

MetaCyc: 62% identical to pantetheine-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Pantetheine-phosphate adenylyltransferase. [EC: 2.7.7.3]

Predicted SEED Role

"Phosphopantetheine adenylyltransferase (EC 2.7.7.3)" in subsystem Coenzyme A Biosynthesis (EC 2.7.7.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UTF1 at UniProt or InterPro

Protein Sequence (159 amino acids)

>PS417_26860 phosphopantetheine adenylyltransferase (Pseudomonas simiae WCS417)
MNRVLYPGTFDPITKGHGDLVERASRLFDHVIIAVAASPKKNPLFPLEQRVELAREVTKH
LPNVEVVGFSTLLAHFAKEQNANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESLFLTPS
ERYSFISSTLVREIAALGGDITKFVHPAVADALTLRFKK