Protein Info for GFF5244 in Sphingobium sp. HT1-2

Annotation: Diguanylate cyclase (EC 2.7.7.65) => Globin-coupled heme-based oxygen sensor DgcO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 PF11563: Protoglobin" amino acids 23 to 160 (138 residues), 53.3 bits, see alignment E=5.1e-18 PF21118: DosC_2nd" amino acids 183 to 287 (105 residues), 55.8 bits, see alignment E=7.4e-19 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 296 to 454 (159 residues), 170 bits, see alignment E=1.8e-54 PF00990: GGDEF" amino acids 296 to 450 (155 residues), 147.5 bits, see alignment E=4.4e-47

Best Hits

KEGG orthology group: K13069, diguanylate cyclase [EC: 2.7.7.65] (inferred from 41% identity to azo:azo3777)

Predicted SEED Role

"Putative Heme-regulated two-component response regulator" in subsystem Putative hemin transporter or cAMP signaling in bacteria

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (470 amino acids)

>GFF5244 Diguanylate cyclase (EC 2.7.7.65) => Globin-coupled heme-based oxygen sensor DgcO (Sphingobium sp. HT1-2)
MFTDEERIKGSAKLPAHSRHSHAPLKLLAEMAAEHGRELVALFYDTLLRDQEAAQFLNHA
VVQERLSSSLIEWLTQLFSGQDIRDSPEKQARQKIIGEVHARIKIPVHLVMTGALVIKTR
LAELLQGQAVDPLVGIRALQLADARMDTAVMLISQSYVKDTTARARLDEAYRLFSLDQDA
AVDKETQRASLMEWSQNTLFALLQAGPGGGLLRLGDSAFGLWLRHRAQFMFEQSAQFSTV
VRLVERIDEMLLPELDAPRKRQDGSSALADLRAAVDEISFLVADLFQTLSTMEGGRDPLT
RALNRRFLPAILGREVTFAKENGTALSVMLVDIDHFKAINDRHGHQVGDEVLRQVAQVIV
GNVRATDFVFRYGGEEFLIVLVETGIEAAANIAERIRADMEGHIFETGSSGGLSVTASIG
IALHSGHPDQKFLIKAADEALYRAKAAGRNTVELAPIYGEGGKGIWPLAT