Protein Info for PS417_26810 in Pseudomonas simiae WCS417

Annotation: cell division protein FtsY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 PF02881: SRP54_N" amino acids 172 to 237 (66 residues), 53.8 bits, see alignment E=5.6e-18 TIGR00064: signal recognition particle-docking protein FtsY" amino acids 186 to 455 (270 residues), 366.4 bits, see alignment E=4.6e-114 PF06414: Zeta_toxin" amino acids 251 to 361 (111 residues), 32.6 bits, see alignment E=1.6e-11 PF01583: APS_kinase" amino acids 255 to 303 (49 residues), 22.5 bits, see alignment 3e-08 PF00448: SRP54" amino acids 255 to 455 (201 residues), 262.3 bits, see alignment E=7.9e-82

Best Hits

KEGG orthology group: K03110, fused signal recognition particle receptor (inferred from 94% identity to pfs:PFLU5780)

Predicted SEED Role

"Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division or Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UTE4 at UniProt or InterPro

Protein Sequence (461 amino acids)

>PS417_26810 cell division protein FtsY (Pseudomonas simiae WCS417)
MFGSNDDKKTPAAAGEKKGLFGWLRKKPQETVDEQPQVQTEPVPEPIVEAEPVAETPAPV
VLPMAEPVLQPLAEAEPEPEPEPAHKPWPELPVAEEPVALVEDVQAEHVVPPIPVVIEPQ
PVVAEAPAPVTVEPAIAAPVIVEEPAAPAETSKTGFFARLKQGLSKTSASIGEGMASLFL
GKKVIDDELLEDIETRLLTADVGVEATAVIIQSLTQKVARKQLTDADALYKSLQAELAAM
LKPVEAPLVITPKKPFVILVVGVNGAGKTTTIGKLAKKLQSEGKKVMLAAGDTFRAAAVE
QLQVWGERNKIPVIAQHTGADSASVIFDAVQAAKARNIDVLIADTAGRLHTKDNLMEELK
KVRRVIGKLDADAPHEVLLVLDAGTGQNAISQAKQFNQTVQLTGLALTKLDGTAKGGVIF
ALAKQFGLPIRYIGVGEGIDDLRTFEAEPFVQALFAERERS