Protein Info for GFF5234 in Variovorax sp. SCN45

Annotation: General secretion pathway protein E / Type II secretion cytoplasmic ATP binding protein (PulE, ATPase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 PF22341: GSPE_N1E" amino acids 5 to 66 (62 residues), 31.1 bits, see alignment E=2.1e-11 PF00437: T2SSE" amino acids 103 to 459 (357 residues), 479.8 bits, see alignment E=4.5e-148

Best Hits

Swiss-Prot: 61% identical to HXCR_PSEAE: Probable type II secretion system protein HxcR (hxcR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02454, general secretion pathway protein E (inferred from 97% identity to vpe:Varpa_1155)

Predicted SEED Role

"General secretion pathway protein E / Type II secretion cytoplasmic ATP binding protein (PulE, ATPase)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>GFF5234 General secretion pathway protein E / Type II secretion cytoplasmic ATP binding protein (PulE, ATPase) (Variovorax sp. SCN45)
MRYPLPYAFARSQQLLLEETDDGRYTLWMSSHPARSAVGEVSRKYGVQTFEVLADGPLAQ
RISAAYAQGESSAAAVVSEVQNDADLSRMMQELPAVEDLLASAGDAPIIRMLNALLTQAA
RDGASDIHIEPYERTSSVRFRIDGTLREVVQPNRALHAALISRLKIMADLDISEKRLPQD
GRISLRIGTRAVDVRVSTLPSAHGERAVLRLLDKSESKLTLESVGMQGDTLDRFEKLISQ
PHGIILVTGPTGSGKTTTLYAALARLDASRSNIMTVEDPIEYELPGVGQTQINAKIELTF
AKALRAILRQDPDVIMIGEIRDFETAQIAIQASLTGHLVLATLHTNDSVSAVTRLTDMGV
EPFLLSSSLLGVLAQRLVRKVCTACAGAGCEVCGQTGYQGRTGIFELLVADETVQGLIHS
KAAESELLQAGARGGLRLMREDGERLVQAGITSRAELLRVTRD