Protein Info for GFF5233 in Variovorax sp. SCN45

Annotation: General secretion pathway protein F / Type II secretory pathway, component PulF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 177 to 200 (24 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 282 to 296 (15 residues), see Phobius details amino acids 381 to 405 (25 residues), see Phobius details PF28597: T2SSF_N" amino acids 1 to 43 (43 residues), 57 bits, see alignment 1.3e-19 TIGR02120: type II secretion system protein F" amino acids 4 to 411 (408 residues), 444.8 bits, see alignment E=1.7e-137 PF00482: T2SSF" amino acids 78 to 201 (124 residues), 110.3 bits, see alignment E=6.6e-36 amino acids 281 to 403 (123 residues), 87 bits, see alignment E=1.1e-28

Best Hits

Swiss-Prot: 40% identical to GSPF_PSEAE: Type II secretion system protein F (xcpS) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02455, general secretion pathway protein F (inferred from 98% identity to vpe:Varpa_1154)

Predicted SEED Role

"General secretion pathway protein F / Type II secretory pathway, component PulF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>GFF5233 General secretion pathway protein F / Type II secretory pathway, component PulF (Variovorax sp. SCN45)
MPAYSFEAIDASGQSREGVLEADTARSARSLLRAQALIPLSVKPVGSDHVNGTGQRSGLG
RWLGGGKRVFNSTGLAVWTRQLAGLVSSGLPLERALTALTDEAESEPQRNLVASLRAEVN
AGSPFARALSAHSREFSPIYTAVIGAGEQSGNLGLVLDRLADDLEERQALQQKLIGAALY
PAIVTLVAIVIVIFLVSYVVPQVAQVFAGTKRSLPFLTTVMLSLSAGVRNYGWWMLGAVV
LGAIGARLALAQEAFRLKFDAAWLKLPLVGKLARGYNAARFASTLAMLATAGVPILRALQ
AASETLGNRAMRADALDALVLVREGAPLASALAQKKRFPGLVSMFARLGEQTGTLPLMLQ
RAANQLGAEVQRRAMHLATILEPLLIVAMGGVVMLIVLAVMLPIIQLNQFVK