Protein Info for GFF523 in Variovorax sp. SCN45

Annotation: Tripartite tricarboxylate transporter TctA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 transmembrane" amino acids 6 to 51 (46 residues), see Phobius details amino acids 58 to 82 (25 residues), see Phobius details amino acids 108 to 135 (28 residues), see Phobius details amino acids 147 to 163 (17 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 320 to 337 (18 residues), see Phobius details amino acids 355 to 378 (24 residues), see Phobius details amino acids 393 to 410 (18 residues), see Phobius details amino acids 417 to 433 (17 residues), see Phobius details amino acids 469 to 491 (23 residues), see Phobius details PF01970: TctA" amino acids 20 to 441 (422 residues), 509.2 bits, see alignment E=3.9e-157

Best Hits

KEGG orthology group: K07793, putative tricarboxylic transport membrane protein (inferred from 96% identity to vap:Vapar_3008)

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (507 amino acids)

>GFF523 Tripartite tricarboxylate transporter TctA family (Variovorax sp. SCN45)
MDIFNALMAGFAAAITPVNLLWCLVGCALGTAVGVLPGIGPAVAVAMLLPITGKVDVTAS
MIFFSGIYYGAMYGGSTTSILLNTPGETASMVTAMEGNKMAKSGRAGAALATAAIGSFVA
GTIATVIVTLFAPFVAEFAVKLGPPEYFMLMLLAFTTVSAVLGKSTLRGMTALFVGLAAG
CIGLDQISGQGRYTGGVPELLDGIEIVLVAVGLFAVAEVLYAVLYEGKVVEGQNKLSRVH
MSKRDWKRSIPAWLRGTAIGTPFGCIPAGGTEIPTFLSYAAEKKLAKDADARAEFGTKGA
IEGVAGPEAANNATVTAALIPLLTLGIPTSNTTAILLGAFQNYGIQPGPQLFTTSAALVW
ALIASLYIGNVMLLVLNLPMVGLWVKLLKIPKPQLYAGILIFATVGAYGMRQSAFDLFLL
FGIGLLGVVMRRFDFPTAPVVVGMILGPLAEAQLRNAMSMGEGSAIVFLQRPMSLTLIVI
VVAVLVLPRLAKRMSERKLARLAQMDA