Protein Info for GFF5229 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 48 to 66 (19 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details PF04290: DctQ" amino acids 24 to 153 (130 residues), 95.3 bits, see alignment E=1.4e-31

Best Hits

Swiss-Prot: 35% identical to Y1030_HAEIN: Putative TRAP transporter small permease protein HI_1030 (HI_1030) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 63% identity to pol:Bpro_4501)

Predicted SEED Role

"TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>GFF5229 TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter (Hydrogenophaga sp. GW460-11-11-14-LB1)
VIQNLINTYCRLLAWLMVLFLACMVVMVFGNVLMRYGFNSGITLSEELSRWLFVWMTFLG
AVVALNERAHLGTDSLISRLPVLGRKLCLAASLGLMLYVCWLIYQGAWEQVKINWDSTSA
VMETSMAYFYASGMVFAVLAAPILLLNLWRLLAGQMSEDELIGIRESEDVPPPGTPGSPQ
P