Protein Info for GFF5224 in Variovorax sp. SCN45

Annotation: Uncharacterized MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 107 to 132 (26 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 354 to 373 (20 residues), see Phobius details amino acids 386 to 407 (22 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 316 (291 residues), 100.8 bits, see alignment E=4e-33 amino acids 235 to 413 (179 residues), 57.9 bits, see alignment E=4.3e-20

Best Hits

KEGG orthology group: None (inferred from 88% identity to vpe:Varpa_1140)

Predicted SEED Role

"Probable oxalate/formate antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>GFF5224 Uncharacterized MFS-type transporter (Variovorax sp. SCN45)
MTTTHETTAHQADSRYAMLRLALTLLIMTVGSSGMYVVSVMLPAVQAEFGIARADASLPY
TLLMLGFGLGGVLMGKLADRVGVMWPLLFGSAFLAAGYIATGLSGGIVSFTIAQALLVGL
LGSSVAFAPLVADTSLWFVKRRGIAVAVCASGNYLAGAVWPPIAQHFVELVGWRQTYIGM
GVFCGVTMALLALCFRARPPALAQAPAKAAASSAAPARDLTRPFGLSMGAAQGLLCVAGV
ACCVAMAMPQVHIVAYCGDLGYGPAQGAMMLSLMLGFGIVSRLVSGVICDRIGGLRTLLL
GGVLQCVALLLFLPFDGLVPLYVISALFGLFQGGIVPSYAIIVREHFPPAEAGARVGTVL
MFTLFGMALGGWMSGKVFDLTGSYHAAFINGIGWNLVNVSIASFLLFRTLRRSGGRVFAL
PAR