Protein Info for GFF5221 in Sphingobium sp. HT1-2

Annotation: Sodium-transporting ATPase subunit E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00137: ATP-synt_C
  • amino acids 10 to 73 (64 residues), 63.4 bits, E=9.1e-22
• TIGR01260: ATP synthase F0, C subunit
  • amino acids 20 to 76 (57 residues), 52.8 bits, E=1.6e-18

Best Hits

Swiss-Prot: 84% identical to ATPL2_RHOS1: ATP synthase subunit c 2 (atpE2) from Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)

KEGG orthology group: K02110, F-type H+-transporting ATPase subunit c [EC: 3.6.3.14] (inferred from 84% identity to azl:AZL_c00790)

MetaCyc: 54% identical to ATP synthase Fo, c subunit (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"ATP synthase F0 sector subunit c"

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Protein Sequence (80 amino acids)

>GFF5221 Sodium-transporting ATPase subunit E (Sphingobium sp. HT1-2)
MNWIHLASILGAAFAISIGAIAPALGQGRAVAAAMDAIARQPEAANTVSRTLFVGLAMIE
TMAIYCLVIALLLLFANPFA