Protein Info for PS417_26705 in Pseudomonas simiae WCS417

Annotation: dihydroorotase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 TIGR00857: dihydroorotase, multifunctional complex type" amino acids 25 to 422 (398 residues), 286.5 bits, see alignment E=1.8e-89 PF01979: Amidohydro_1" amino acids 162 to 419 (258 residues), 45.4 bits, see alignment E=7.1e-16 PF07969: Amidohydro_3" amino acids 341 to 421 (81 residues), 32.5 bits, see alignment E=7.2e-12

Best Hits

Swiss-Prot: 83% identical to PYRX_PSEPU: Dihydroorotase-like protein (pyrC') from Pseudomonas putida

KEGG orthology group: K01465, dihydroorotase [EC: 3.5.2.3] (inferred from 98% identity to pfs:PFLU5759)

Predicted SEED Role

"Dihydroorotase (EC 3.5.2.3)" in subsystem De Novo Pyrimidine Synthesis (EC 3.5.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.3

Use Curated BLAST to search for 3.5.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UMC1 at UniProt or InterPro

Protein Sequence (423 amino acids)

>PS417_26705 dihydroorotase (Pseudomonas simiae WCS417)
MKLSILGARVIDPASGLDHVTDLHLEAGKLIAIGAAPAGFSATETIDANGLVAAPGLVDL
NVALREPGYSRKGNITSETRAAAAGGVTSLCCPPHTKPVLDTSAVTELILDRAREAGNCK
VFPIGALSKGLEGEQLAELIALRDAGCVAFGNGLESFRSTRTLLRALEYAATFDLTVIFH
SQDRDLAEGGLAHEGAVASFLGLPGIPETAETVALARDLLLVEQSGVRAHFSQLTSARGV
ALIAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPPLRTLADREGLRAAVKSGVV
SAISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVEDGLLDLPTLLARLSAGPAE
ALRLPAGKLAVGSAADLVLFDPASSTIAGEQWLSKGENCPFIGHSLPATVRYTLVDGRIS
YQA