Protein Info for PS417_26700 in Pseudomonas simiae WCS417

Annotation: aspartate carbamoyltransferase catalytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02729: OTCace_N
  • amino acids 19 to 163 (145 residues), 145.9 bits, E=9.6e-47
• TIGR00670: aspartate carbamoyltransferase
  • amino acids 20 to 319 (300 residues), 294.9 bits, E=3.1e-92
• PF00185: OTCace
  • amino acids 171 to 317 (147 residues), 88.3 bits, E=6e-29

Best Hits

Swiss-Prot: 99% identical to PYRB_PSEFS: Aspartate carbamoyltransferase (pyrB) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 99% identity to pfs:PFLU5758)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• UMP biosynthesis I (6/6 steps found)
• UMP biosynthesis II (6/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.2

Sequence Analysis Tools

See U1UJB1 at UniProt or InterPro

Protein Sequence (334 amino acids)

>PS417_26700 aspartate carbamoyltransferase catalytic subunit (Pseudomonas simiae WCS417)
MTPLDAKRPLQLNAQGQLQHFLSLDGLPRELLTEILDTADSFLEVGGRAVKKVPLLRGKT
ICNVFFENSTRTRTTFELAAQRLSADVITLNVSTSSASKGETLLDTLRNLEAMAADMFVV
RHGDSGAAHFIAEHVCPQVAIINGGDGRHAHPTQGMLDMLTIRRHKGSFENLSVAIVGDI
LHSRVARSNMLALKALGCPDIRVIAPKTLLPIGIEQYGVKVYTDMAEGLKDVDVVIMLRL
QRERMAGGLLPSEGEFYRLFGLTTARLAGAKPDAIVMHPGPINRGVEIESAVADGPQSVI
LNQVTYGIAVRMAVLSMAMSGQTAQRQFEQENAQ