Protein Info for PS417_26700 in Pseudomonas simiae WCS417

Annotation: aspartate carbamoyltransferase catalytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF02729: OTCace_N" amino acids 19 to 163 (145 residues), 144.4 bits, see alignment E=2.9e-46 TIGR00670: aspartate carbamoyltransferase" amino acids 20 to 319 (300 residues), 294.9 bits, see alignment E=3.1e-92 PF00185: OTCace" amino acids 171 to 317 (147 residues), 85 bits, see alignment E=5.9e-28

Best Hits

Swiss-Prot: 99% identical to PYRB_PSEFS: Aspartate carbamoyltransferase (pyrB) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 99% identity to pfs:PFLU5758)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1UJB1 at UniProt or InterPro

Protein Sequence (334 amino acids)

>PS417_26700 aspartate carbamoyltransferase catalytic subunit (Pseudomonas simiae WCS417)
MTPLDAKRPLQLNAQGQLQHFLSLDGLPRELLTEILDTADSFLEVGGRAVKKVPLLRGKT
ICNVFFENSTRTRTTFELAAQRLSADVITLNVSTSSASKGETLLDTLRNLEAMAADMFVV
RHGDSGAAHFIAEHVCPQVAIINGGDGRHAHPTQGMLDMLTIRRHKGSFENLSVAIVGDI
LHSRVARSNMLALKALGCPDIRVIAPKTLLPIGIEQYGVKVYTDMAEGLKDVDVVIMLRL
QRERMAGGLLPSEGEFYRLFGLTTARLAGAKPDAIVMHPGPINRGVEIESAVADGPQSVI
LNQVTYGIAVRMAVLSMAMSGQTAQRQFEQENAQ