Protein Info for GFF5208 in Variovorax sp. SCN45

Annotation: Efflux ABC transporter, permease/ATP-binding protein Reut_A2584

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 673 transmembrane" amino acids 81 to 103 (23 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 197 to 221 (25 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details amino acids 309 to 331 (23 residues), see Phobius details amino acids 337 to 355 (19 residues), see Phobius details PF00664: ABC_membrane" amino acids 81 to 354 (274 residues), 156.3 bits, see alignment E=1.4e-49 PF00005: ABC_tran" amino acids 420 to 568 (149 residues), 114.3 bits, see alignment E=7e-37

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 93% identity to vap:Vapar_1060)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (673 amino acids)

>GFF5208 Efflux ABC transporter, permease/ATP-binding protein Reut_A2584 (Variovorax sp. SCN45)
LTGSAGRLGRWRYTLAHQVAALRLLKLFGQRMAGVSKATPEVIEAADGDDLAGADAERQS
PPSTWVLLRLGRFAKPYRKQLILGFVLTLISTAATLVPPYLTIPLMDDILIPFQNGQKID
TMRVGLYLGGLLVAALVGWGLGWARTYLLALVSERIGADLRTTTYEHLLTLPLDYFGGKR
TGDLMARIGSETDRINVFLSLHALDFANDVLMIVMTAVILISINPLLAVVTLVPLPFIAW
MIHVVRDRLRTGFEKIDRVWSEVTNVLADTIPGIRVVKAFAQERREAERFRVANAYNLQV
NDKLNRTWSLFTPTVSLLTEIGLLVVWAFGIWQVARGSITVGVLTAFIAYIGRFYTRLDS
MSRIVSVTQKAAAGAKRIFDILDHVSNVPEPANPVKVERVQGRIEMSGLGFRYGSRAVIH
DLDLVIEPGEMIGLVGHSGSGKSTLVNLICRFYDVTDGAIKVDGTDIRRFAVADYRRHVG
LVLQEPFLFFGTIAQNIAYGKPDATREEIVAAARAAHAHDFILRLQHGYDSLVGERGQGL
SGGERQRISIARALLIDPRILILDEATSAVDTETEKEIQKALDNLVQGRTTIAIAHRLST
LRKADRLVVMDRGEVVEVGPHDALMAKQGAYWRLYQAQLRQGDDDASEGAADERASAQAP
LPIAHAAHPAGDA