Protein Info for GFF5206 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 36 to 54 (19 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 279 to 296 (18 residues), see Phobius details PF00892: EamA" amino acids 3 to 114 (112 residues), 35.7 bits, see alignment E=4.7e-13

Best Hits

KEGG orthology group: None (inferred from 59% identity to aaa:Acav_2134)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>GFF5206 Integral membrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MVTGILAGLGAGAFWGTAFLAPLLTPGFSSIDLTVGRFLACGLLSVLLLAWAGLRGEAHL
PTWRQAGSALWLSLLGYTGYYLLLVLAIQAAGAALPVLIIGTIPIWIMLLGKPQGLRWRA
LVPGLLLTMAGLALMMRVTAHGAGEAGGGDDLWLGIFFAVLAMASWTAFGLLNARWLSHH
PEVNSTVWANWLGVAAGLGALVIWAVAGAGVDTLVQRPGFDRFLVVCAVTGIGSAWIASV
LWNMASRRLSPSLAGQLIVSETVFGLIYTFAWSAQWPAALQWTACVLFVLGILASIKAHR