Protein Info for GFF5205 in Sphingobium sp. HT1-2

Annotation: Copper resistance protein CopD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 68 (26 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 157 to 181 (25 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 283 to 306 (24 residues), see Phobius details PF05425: CopD" amino acids 198 to 305 (108 residues), 92 bits, see alignment E=1.5e-30

Best Hits

KEGG orthology group: K07245, putative copper resistance protein D (inferred from 98% identity to sch:Sphch_4179)

Predicted SEED Role

"Copper resistance protein D" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>GFF5205 Copper resistance protein CopD (Sphingobium sp. HT1-2)
MNDVALVAVRWALYVDLGLLFGLPLFALYAPGGGRMVQRHLPMVAMVAGLACLALLLSAL
GFALQAAAMTGLPLTQPDLSMVAELFNGTSMGTALKARLVALLVLLLSIPFYRRQSRPAF
IASTLAGAVALATLAWSGHGAAGEGEAGWLQLGADLIHLLAAGAWVGALAAFLALVLXRL
ATDDLAXZDMDRVXLAEEALRGFSLVGTIIVALLILTGTVNGWFLVGPGNIASLGQSTYG
LLLIAKLLLFAGMLGLAALNRYRLTPALAQAIEEEDAPRAQALLRASLVVEGGLAIVILG
LVAWLGTLSPPMSM