Protein Info for GFF5198 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein (cluster 2, ribose/xylose/arabinose/galactose)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 50 to 69 (20 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 254 to 273 (20 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 306 to 323 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 47 to 319 (273 residues), 141 bits, see alignment E=2.2e-45

Best Hits

Swiss-Prot: 48% identical to YTFT_ECOLI: Inner membrane ABC transporter permease protein YtfT (ytfT) from Escherichia coli (strain K12)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 94% identity to vap:Vapar_1049)

MetaCyc: 48% identical to galactofuranose ABC transporter putative membrane subunit YtfT (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-491 [EC: 7.5.2.9]; 7.5.2.9 [EC: 7.5.2.9]

Predicted SEED Role

"Putative sugar ABC transport system, permease protein YtfT"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>GFF5198 ABC transporter, permease protein (cluster 2, ribose/xylose/arabinose/galactose) (Variovorax sp. SCN45)
MKRLSSFMSHRLAWPLITLLLLLAVNTAFNASFLHLEWRDGHLYGSLIDILNRAAPLVLV
SLGMTLVIATRGIDISVGAVVAIAASLAAWMIGGSVASDVSRFPMSLAILAAIGIALVCG
LWNGLLVAKVGMQPIIATLILMVAGRGIAQLIADGQIITIYYKPFFFLGSGYLLGLPFSL
FLVAAVFVLLYLAITRTALGLFIQAVGINPTAARVAGVQARRLIVGAYAFCGACAGVAGL
LISSNVKSADGNNAGQLIELDAILAVTLGGTALTGGRFSLVGSVIGTLIIQTLTYAIYSL
GVPPEINLVVKAAVVFAVMLLQSPEFRSEVRSLVQRPAHEGERA