Protein Info for PS417_26610 in Pseudomonas simiae WCS417

Annotation: malonate decarboxylase subunit delta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 99 TIGR03130: malonate decarboxylase acyl carrier protein" amino acids 2 to 95 (94 residues), 116.6 bits, see alignment E=1.9e-38 PF06857: ACP" amino acids 17 to 95 (79 residues), 86.6 bits, see alignment E=5.6e-29

Best Hits

Swiss-Prot: 97% identical to MDCC_PSEFS: Malonate decarboxylase acyl carrier protein (mdcC) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K13931, malonate decarboxylase delta subunit (inferred from 97% identity to pfs:PFLU5741)

Predicted SEED Role

"Malonate decarboxylase delta subunit" in subsystem Malonate decarboxylase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UT81 at UniProt or InterPro

Protein Sequence (99 amino acids)

>PS417_26610 malonate decarboxylase subunit delta (Pseudomonas simiae WCS417)
METLSFEFPAGQPPTGRALVGCVGSGDLEVLLEPGTPGRLTIQVQTSVNGAEQRWQHLFE
RIFQEQTPPALKIDIHDFGATPGVVRLRLEQGFEEIGHD