Protein Info for GFF5189 in Sphingobium sp. HT1-2

Annotation: Lipoprotein signal peptidase (EC 3.4.23.36)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 transmembrane" amino acids 6 to 32 (27 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 97 to 113 (17 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 17 to 161 (145 residues), 114.2 bits, see alignment E=2.9e-37 PF01252: Peptidase_A8" amino acids 18 to 155 (138 residues), 121.7 bits, see alignment E=1.5e-39

Best Hits

Swiss-Prot: 37% identical to LSPA_PSESM: Lipoprotein signal peptidase (lspA) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 65% identity to mes:Meso_4211)

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.23.36

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>GFF5189 Lipoprotein signal peptidase (EC 3.4.23.36) (Sphingobium sp. HT1-2)
VQSRTLVGRAALAGAALFIALTIDFVTKWLIVNIVMIPPHMIKITPFFNLVLGFNTGVSF
GMFRELFVEQPLLLAAIMAAITAGLLVWAVRTTRRIETFALGLIAGGAAGNVVDRVRHGA
VTDFLDLHVGDWHWPAFNMADVMITVGVVLLITGSLWPARSTVSIAKAPGRSRFVG