Protein Info for PS417_26560 in Pseudomonas simiae WCS417

Annotation: amino acid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF00070: Pyr_redox" amino acids 2 to 35 (34 residues), 25.4 bits, see alignment 4.9e-09 PF01266: DAO" amino acids 2 to 389 (388 residues), 231.8 bits, see alignment E=5.6e-72 PF00890: FAD_binding_2" amino acids 2 to 44 (43 residues), 22.8 bits, see alignment 1.6e-08 PF13450: NAD_binding_8" amino acids 4 to 37 (34 residues), 31.5 bits, see alignment 5.5e-11

Best Hits

Swiss-Prot: 70% identical to DADA2_PSEAE: D-amino acid dehydrogenase 2 (dadA2) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00285, D-amino-acid dehydrogenase [EC: 1.4.99.1] (inferred from 93% identity to pfs:PFLU5731)

Predicted SEED Role

"D-amino acid dehydrogenase small subunit (EC 1.4.99.1)" in subsystem Pyruvate Alanine Serine Interconversions or Respiratory dehydrogenases 1 (EC 1.4.99.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.99.1

Use Curated BLAST to search for 1.4.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UT59 at UniProt or InterPro

Protein Sequence (407 amino acids)

>PS417_26560 amino acid dehydrogenase (Pseudomonas simiae WCS417)
MVCIIGGGVIGLASAYALVRAGHEVTLIDARETLGSETSFANGGQLSYRYVAPLADAGVP
LQAIGWLLRGDSPLKLRPRLDPQQWRWMAAFLGACRGSVNKRNAAHLLRLASLSQDTLQV
WRDLDRLDGFDWRRNGKLVTFRNANAFERARGKVTDILQQQVLSTADCARLEPALADGGF
VGGIYTPNEEVADCHAFCQRLAARLEASGRCRFMLGRKVTGIRHAKGRVQAIELGDEVMP
VEHLVLAAGYRSAELGVPLPLYPLKGYSLSVPIGAQHQAPNVSITDYDRKIVYARIGEQL
RVAAMVDIVGFDARLEPKRLALMKRQALEIFPLAGDYDQAVEWAGMRPATPTGVPLIGAS
VYRNLWLNLGHGALGFTLACGSGQLLAELIGQHAPSIDMQGLAPRAA