Protein Info for GFF518 in Variovorax sp. SCN45

Annotation: Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 PF14532: Sigma54_activ_2" amino acids 189 to 360 (172 residues), 63.6 bits, see alignment E=8.7e-21 PF00158: Sigma54_activat" amino acids 189 to 355 (167 residues), 219.7 bits, see alignment E=7e-69 PF25601: AAA_lid_14" amino acids 361 to 438 (78 residues), 65.8 bits, see alignment E=9.1e-22 PF02954: HTH_8" amino acids 468 to 505 (38 residues), 47.5 bits, see alignment 4.1e-16

Best Hits

KEGG orthology group: None (inferred from 95% identity to vap:Vapar_2414)

Predicted SEED Role

"Sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (510 amino acids)

>GFF518 Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains (Variovorax sp. SCN45)
MPVSPSLPPALPLDAQGILALAARSMFHLFSSISQGMFLVDRGGRIVWVNEGYRRFLPAL
GFSSIDQFMGHMVEDVIPNTQMRRVLETGEPILIDLLTNKAGTFVVSRIPLREEREGADG
GMGEVIGAIGIVLFDQPETTLQPLISKFALLQRDLDDARRELASQRNNPLYQHAADGQRR
SKYTFASFIGSSPAAVEVKRHARRAAQSTSPVLLLGETGTGKELLAHAIHASSARAKGQF
VSVNIAAVPDTLLEAEFFGFAPGAFTGADRKGREGKFKLADGGSLFLDEIGDMPLGLQAK
LLRALQEGEIEPLGSNKLVPFDARVIAATSRDLPELVRRGQFREDLYYRLNVLPLRVPPL
RERRADIPALVEALGEDMALRSGEAPPELTPDALALLAGQHWRGNIRELRNVLEQVTMRS
DSQRIDSAQLERILREAGLEQIELPATLQSAHDTDEEAALLRPLAQQVAELERKAIAAAL
ASTGGNKLATARLLGISRATLYERMTSQEH