Protein Info for GFF5172 in Sphingobium sp. HT1-2

Annotation: group 1 glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF20706: GT4-conflict" amino acids 10 to 367 (358 residues), 39.7 bits, see alignment E=7.7e-14 PF13579: Glyco_trans_4_4" amino acids 15 to 180 (166 residues), 42.4 bits, see alignment E=2.5e-14 PF13439: Glyco_transf_4" amino acids 15 to 185 (171 residues), 50.9 bits, see alignment E=4.9e-17 PF00534: Glycos_transf_1" amino acids 207 to 347 (141 residues), 57.1 bits, see alignment E=4.4e-19 PF13692: Glyco_trans_1_4" amino acids 215 to 346 (132 residues), 53.2 bits, see alignment E=1e-17

Best Hits

KEGG orthology group: None (inferred from 56% identity to swi:Swit_1814)

Predicted SEED Role

"Glycosyl transferase, group 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>GFF5172 group 1 glycosyl transferase (Sphingobium sp. HT1-2)
MRIVDVCAFYAPQGGGVKTYVERKLHAGAAAGHDIIILAPGEKLARRPARGGSVVTIPAK
RFPLDRRYHYFDDEAALHRMLDALAPDLVEASSPWSSASMVARWRGDVPRALVMHADPLS
AYAYRWFGNVAPRAAIDRGFDWYWRHLRRLGQAFDMVVSANDSLSARLRAGGVGSVCTVP
MGVEPHIFTPSHRDAALRRHLLARCGLDENGLLLMGVGRHAPEKRWPMVIQAATLAGYRR
PVGLVLLGDGRDSARVRRAAAHNPHIHLLAPTTDRRRLASLLASADALVHGCEAETFCMT
AAEARASGVPVIVPDEGGAADHARSGIGLRFRAGDTASLVEAIENFAATDPDIWRSRAAT
AAASVTTMDEHFSWLFEAYSSLRTAVRHAA