Protein Info for PS417_26485 in Pseudomonas simiae WCS417

Annotation: sodium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 50 (21 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 127 to 151 (25 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 232 to 249 (18 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 318 to 341 (24 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details amino acids 380 to 400 (21 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 11 to 405 (395 residues), 234.5 bits, see alignment E=9.2e-74

Best Hits

Swiss-Prot: 75% identical to NHAP_PSEAE: Na(+)/H(+) antiporter NhaP (nhaP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03316, monovalent cation:H+ antiporter, CPA1 family (inferred from 99% identity to pfs:PFLU5716)

Predicted SEED Role

"Na+/H+ antiporter NhaP"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UGI9 at UniProt or InterPro

Protein Sequence (419 amino acids)

>PS417_26485 sodium:proton antiporter (Pseudomonas simiae WCS417)
MLELVAAFICLTTLLTYVNFRFIGLPPTIGVMVTALVFSLILQGLSVLGYPGLEERIQQL
IGQIDFGDLLMNWMLSFLLFAGALHVNLNDLRSYRWPIGLLATFGVLIATVVIGSLAYYI
FALFGWHVSFLYCLLFGALISPTDPIAVLGVLRTANASKPLKTTIVGESLFNDGTAVVVF
TVLLGIAQLGETPTVGATAMLFAHEAIGGVAFGGLIGYLVYLMIKSIEQHQIEVMLTLAL
VIGGSAMATELHVSAPIAMVVAGLIIGNLGRKLAMNDMTRRYLDGFWELLDDMLNALLFA
LIGMELLLLPFNWLHVLAASLLAVAILLSRLLTVAPAILLLRRWRTVPRGTIRILTWGGL
RGGVSVALALALPLGPERDLLLSITYIVVLSSILLQGLSIGKLVKRVTRDEPQAAPDTH