Protein Info for GFF5171 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Aspartate aminotransferase (EC 2.6.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 97 to 115 (19 residues), see Phobius details PF00155: Aminotran_1_2" amino acids 35 to 402 (368 residues), 195.3 bits, see alignment E=2.8e-61 PF00266: Aminotran_5" amino acids 95 to 206 (112 residues), 22.4 bits, see alignment E=8.4e-09 PF01053: Cys_Met_Meta_PP" amino acids 97 to 209 (113 residues), 27.3 bits, see alignment E=2e-10

Best Hits

KEGG orthology group: None (inferred from 73% identity to pol:Bpro_2888)

Predicted SEED Role

"Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1

Use Curated BLAST to search for 2.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>GFF5171 Aspartate aminotransferase (EC 2.6.1.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRIAQRAQRVEPFYVMELAKAASAMAAQAGAGDRPMIYLNIGEPDFTAPPLVTAAAERAI
HAGRSQYTQATGLPPLREAIGGWYASRFGLRIDPARIVITAGASAALQLACLALIEAGDE
VLMPDPSYPCNRQFVQAAEGRAVLIPSGPEQRFQLSAEQVDAAWGPATRGVLLASPSNPT
GTSIAREELERITRLVRDRGGVTLVDEIYLGLSFEDEYGHSALGLPDGLGDEVISINSFS
KYFNMTGWRLGWLVLPPALVPAVERLAQNLFICASTIAQHAALACFEPDSLGEYERRRAA
FKARRDYFIPELDRLGLNVPVMPDGAFYAWADVRGLCERWGIPPQGTRPDEGGSWALAFE
LMKRCQLATTPGRDFGQADPGRYLRFSTANSMAQLQEAVARLEQAL