Protein Info for PS417_26480 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 65 to 91 (27 residues), see Phobius details amino acids 99 to 99 (1 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details PF01124: MAPEG" amino acids 3 to 127 (125 residues), 95.5 bits, see alignment E=1.4e-31

Best Hits

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU5715)

Predicted SEED Role

"probable membrane protein NMA1176"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UPZ9 at UniProt or InterPro

Protein Sequence (128 amino acids)

>PS417_26480 membrane protein (Pseudomonas simiae WCS417)
MTVAFWCVLIAIFLPYLCTGVAKFSGGKFGPRQNHDPRAFLDTLEGFAKRAHSAQLNSFE
VTPAFAAAVIIAHLAGTAELVTINVLAVLFITSRLLYIICYLADWAMLRSLVWFVGMALI
ASFFFVSI