Protein Info for GFF5162 in Variovorax sp. SCN45

Annotation: Mg(2+)-transport-ATPase-associated protein MgtC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details PF02308: MgtC" amino acids 31 to 154 (124 residues), 123.3 bits, see alignment E=3.8e-40

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 88% identity to vpe:Varpa_1058)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (189 amino acids)

>GFF5162 Mg(2+)-transport-ATPase-associated protein MgtC (Variovorax sp. SCN45)
MSWRDEVLNTIASEFSDVTDVAQLTRIVLRLTLAAALGFVLGFEREQAGKAAGVRTHMLV
AIGSAMFVLIPQQTGIVPADMSRVIQGLVAGVGFLCAGTILKQGKDESHVQGLTTAAGLW
MTAAIGMACGLGREATALLSALLALAVLSLVPRLVGLIERAIGPPRGVKDGAAPRVIASS
SDDNGAPRR