Protein Info for PS417_26435 in Pseudomonas simiae WCS417

Annotation: glyceraldehyde-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF00044: Gp_dh_N" amino acids 8 to 109 (102 residues), 116.1 bits, see alignment E=7.8e-38 TIGR01532: erythrose-4-phosphate dehydrogenase" amino acids 8 to 336 (329 residues), 576.4 bits, see alignment E=8.9e-178 PF02800: Gp_dh_C" amino acids 167 to 323 (157 residues), 164.6 bits, see alignment E=1.4e-52

Best Hits

Swiss-Prot: 53% identical to E4PD_PECCP: D-erythrose-4-phosphate dehydrogenase (epd) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03472, D-erythrose 4-phosphate dehydrogenase [EC: 1.2.1.72] (inferred from 98% identity to pfs:PFLU5706)

MetaCyc: 54% identical to D-erythrose-4-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Erythrose-4-phosphate dehydrogenase. [EC: 1.2.1.72]

Predicted SEED Role

"D-erythrose-4-phosphate dehydrogenase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UGH8 at UniProt or InterPro

Protein Sequence (351 amino acids)

>PS417_26435 glyceraldehyde-3-phosphate dehydrogenase (Pseudomonas simiae WCS417)
MPQPRRYKVALNGYGRIGRCVLRALFERGADAGFEIVAINDLADMASIEYLTRFDSTHGR
FPGEVRVEGDCLHINGNCVQVLRSATPEGIDWTALGVDLVLECSGVYHTRADGQRFLDAG
APRVLFSQPMASEADVDATIVYGINQDCLTGDELLVSNASCTTNCSVPLLRLLDQAIGLD
YVSITTIHSAMNDQPVIDAYHHEDLRRTRSAFQSVIPVSTGLARGIERLLPELAGRIQAK
AVRVPTVNVSCLDITMQTVSDTDATEVNRILRDAATSGPLKGLLAYTELPHASCDFNHDP
HSAIVDASQTRVSGPRLVNILAWFDNEWGFANRMLDVAEHYLHIASKQPQQ