Protein Info for GFF5161 in Sphingobium sp. HT1-2

Annotation: putative membrane-associated phospholipid phosphatase, PAP2 superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 204 to 222 (19 residues), see Phobius details PF01569: PAP2" amino acids 107 to 223 (117 residues), 80.3 bits, see alignment E=5.7e-27

Best Hits

KEGG orthology group: None (inferred from 51% identity to rlg:Rleg_6892)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>GFF5161 putative membrane-associated phospholipid phosphatase, PAP2 superfamily (Sphingobium sp. HT1-2)
MPSVLQKLSARHRIDSYILVMFLAAAAGILLFLKLGSEILEGDSFAIDRYLLQCLRRSSD
SAIPIGPAWLRSAMVDISALGGINLLTLITLLASGYLLAARKQVTALFLPISIAAGAAMS
ALFKIEYARPRPDIVKHLVEVSSASFPSGHAMNSAIVYLTVGALLARAEQAPRVRIYIIS
VAICLTLAIGSSRIYLGVHWPSDVVAGWCVGASWAAMALLIAHRLPGARAGVGPESLSGS
SVYLSNRDHES