Protein Info for GFF516 in Xanthobacter sp. DMC5

Annotation: 3-methylmercaptopropionyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 PF12418: AcylCoA_DH_N" amino acids 4 to 34 (31 residues), 43.6 bits, see alignment (E = 8.2e-15) PF02771: Acyl-CoA_dh_N" amino acids 40 to 156 (117 residues), 42.6 bits, see alignment E=2.6e-14 PF02770: Acyl-CoA_dh_M" amino acids 161 to 271 (111 residues), 49.2 bits, see alignment E=1.7e-16 PF00441: Acyl-CoA_dh_1" amino acids 282 to 450 (169 residues), 70.6 bits, see alignment E=5.8e-23 PF22924: ACOX_C_alpha1" amino acids 291 to 446 (156 residues), 37.6 bits, see alignment E=7.1e-13 PF08028: Acyl-CoA_dh_2" amino acids 298 to 443 (146 residues), 29.5 bits, see alignment E=3e-10 PF12806: Acyl-CoA_dh_C" amino acids 474 to 592 (119 residues), 124.3 bits, see alignment E=1.1e-39

Best Hits

KEGG orthology group: None (inferred from 94% identity to xau:Xaut_4445)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7

Use Curated BLAST to search for 1.3.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (596 amino acids)

>GFF516 3-methylmercaptopropionyl-CoA dehydrogenase (Xanthobacter sp. DMC5)
MQVYTPPLRDMRFVLHELHGSEELSKLKGLEELSPDLIDAVLEEAGKFVTEVLAPLNQSG
DLEGCTYENGVVRTPKGFKEAYTAFREGGWNGIACDPKYGGQGLPASVNKLVEEMLCSGN
LAFGICPGLTHGAYQALKAYASEELKERFLPKMVDGVWSGSMCLTEPQCGTDLGLVRTKA
EPKADGSYKITGNKIFISAGEQDMTENIVHLVLARLPDAPKGIKGISLFLVPKFLPKEDG
SVGPRNGVLCTGIEHKMGIHGSSTCQMSFDEATGWLVGEPHKGMRAMFAMMNSERLSVGT
QGLGLGEAAYQAAVVYAKERLQGRALSGAKHPDKPADPIIVHPDVRRTLMTMRAYNEGCR
ALAGWVARALDLMERAEDPEESKRAEDFTALMTPIVKALFTDLGFEATSMGMQVYGGHGY
IRDHGMEQYVRDARIAMIYEGTNGVQALDLVGRKLPAHMGRYLRSFFHPVLNYMDAKLDD
ENLGPLITPLSKAFGALQLATAHIAEKGLKDPEEAGAAATEYLRLFGLVALGYMWVRMAE
VAFEKRVSNPDDAAFYDAKIVTARFFMEKLLPDVAALWGSIKAGKGSMMALDEAMF