Protein Info for PS417_26390 in Pseudomonas simiae WCS417

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF00583: Acetyltransf_1" amino acids 20 to 130 (111 residues), 33.2 bits, see alignment E=8.3e-12 PF13673: Acetyltransf_10" amino acids 27 to 149 (123 residues), 66.1 bits, see alignment E=4.7e-22 PF13508: Acetyltransf_7" amino acids 49 to 131 (83 residues), 31.6 bits, see alignment E=2.7e-11

Best Hits

Swiss-Prot: 51% identical to ELAA_ECOLI: Protein ElaA (elaA) from Escherichia coli (strain K12)

KEGG orthology group: K02348, ElaA protein (inferred from 95% identity to pfs:PFLU5695)

Predicted SEED Role

"ElaA protein" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U512 at UniProt or InterPro

Protein Sequence (150 amino acids)

>PS417_26390 acyltransferase (Pseudomonas simiae WCS417)
MTIEWVCKHHDDLGKEQLYAILRLRNEVFVVEQKCAYQDLDGQDLSGDTHHLMAWQDDQL
VAYLRLLDPESQGGDVVIGRVIVASVARGTGLGHQMMEETLKRIGDIWPQTPIFLSAQAH
LQGYYGRYGFVVAGEEYLEDDIPHIGMRKD