Protein Info for GFF5147 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 transmembrane" amino acids 19 to 36 (18 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details PF01545: Cation_efflux" amino acids 56 to 219 (164 residues), 41.3 bits, see alignment E=7.5e-15

Best Hits

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>GFF5147 hypothetical protein (Sphingobium sp. HT1-2)
MACLSWSGIANVALERRDLLWTLTIIVTMGLVLGQSQTMKTAWIEDTLGLVPPVMFLIAA
HMERHAHRSRRFPFGFERVNGLGFFVAAVALTAVGALLLYNALMALGAAEHASVGSIAIL
GQDIWLGWLMIAAQIYSLIPPLFIGRKELPLAQALNDKLLHTDALMNKANWLTGAAGLAG
IIGLGLGWWWADSVAAAIISLDVLNDGIKALRSSTAELVDGAPRALSSTDLSDDAQNLCD
RLKAEFPGGTIRLRETGRLIRAEVHDTPPPRNAVIRDITGQRARTERGGWLR