Protein Info for GFF5135 in Sphingobium sp. HT1-2

Annotation: Mg(2+)-transport-ATPase-associated protein MgtC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details PF02308: MgtC" amino acids 20 to 147 (128 residues), 93.5 bits, see alignment E=6.3e-31

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 44% identity to rce:RC1_3382)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>GFF5135 Mg(2+)-transport-ATPase-associated protein MgtC (Sphingobium sp. HT1-2)
MTLNPDTPLHLIDGPVMLRLSIAALLGLLLGLDRQIRGHAAGLRTHGLICFTSALMTVCA
IALHNQLQGEGNIDPLRVFEASAAFSGIIATGLIIFSKGEIKNLTTAAHIWLASMIGIAC
GAALWPLVASATLVAILMLSLLGFVERRWLASEERQGK