Protein Info for PS417_26285 in Pseudomonas simiae WCS417
Annotation: 3-hydroxybutyryl-CoA dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 92% identical to LCDH_PSEU2: L-carnitine dehydrogenase (lcdH) from Pseudomonas syringae pv. syringae (strain B728a)
KEGG orthology group: K00074, 3-hydroxybutyryl-CoA dehydrogenase [EC: 1.1.1.157] (inferred from 97% identity to pfs:PFLU5675)MetaCyc: 85% identical to L-carnitine dehydrogenase (Pseudomonas aeruginosa PAO1)
Carnitine 3-dehydrogenase. [EC: 1.1.1.108]
Predicted SEED Role
"Carnitine 3-dehydrogenase (EC 1.1.1.108) @ 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) @ 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35)" (EC 1.1.1.108, EC 1.1.1.157, EC 1.1.1.35)
MetaCyc Pathways
- oleate β-oxidation (30/35 steps found)
- fatty acid salvage (6/6 steps found)
- adipate degradation (5/5 steps found)
- 2-methyl-branched fatty acid β-oxidation (11/14 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
- L-carnitine degradation III (3/3 steps found)
- benzoyl-CoA biosynthesis (3/3 steps found)
- valproate β-oxidation (7/9 steps found)
- (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (4/5 steps found)
- 4-hydroxybenzoate biosynthesis III (plants) (4/5 steps found)
- adipate biosynthesis (4/5 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
- fatty acid β-oxidation I (generic) (5/7 steps found)
- pyruvate fermentation to butanol II (engineered) (4/6 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
- D-carnitine degradation II (1/2 steps found)
- fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
- glutaryl-CoA degradation (3/5 steps found)
- pyruvate fermentation to hexanol (engineered) (7/11 steps found)
- fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
- L-glutamate degradation V (via hydroxyglutarate) (6/10 steps found)
- methyl ketone biosynthesis (engineered) (3/6 steps found)
- superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
- glycerol degradation to butanol (10/16 steps found)
- benzoyl-CoA degradation I (aerobic) (3/7 steps found)
- pyruvate fermentation to butanoate (3/7 steps found)
- pyruvate fermentation to butanol I (3/8 steps found)
- methyl tert-butyl ether degradation (4/10 steps found)
- benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
- phenylacetate degradation I (aerobic) (3/9 steps found)
- 2-methylpropene degradation (2/8 steps found)
- superpathway of phenylethylamine degradation (4/11 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (9/18 steps found)
- 3-phenylpropanoate degradation (3/10 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
- L-tryptophan degradation III (eukaryotic) (6/15 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
- L-glutamate degradation VII (to butanoate) (3/12 steps found)
- crotonate fermentation (to acetate and cyclohexane carboxylate) (4/16 steps found)
- benzoate fermentation (to acetate and cyclohexane carboxylate) (4/17 steps found)
- toluene degradation VI (anaerobic) (4/18 steps found)
- cholesterol degradation to androstenedione I (cholesterol oxidase) (2/17 steps found)
- androstenedione degradation I (aerobic) (6/25 steps found)
- platensimycin biosynthesis (6/26 steps found)
- cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (3/22 steps found)
- superpathway of testosterone and androsterone degradation (6/28 steps found)
- androstenedione degradation II (anaerobic) (4/27 steps found)
- superpathway of cholesterol degradation I (cholesterol oxidase) (8/42 steps found)
- superpathway of cholesterol degradation II (cholesterol dehydrogenase) (9/47 steps found)
- superpathway of cholesterol degradation III (oxidase) (5/49 steps found)
KEGG Metabolic Maps
- Benzoate degradation via CoA ligation
- Bile acid biosynthesis
- Biosynthesis of plant hormones
- Butanoate metabolism
- Caprolactam degradation
- Fatty acid elongation in mitochondria
- Fatty acid metabolism
- Geraniol degradation
- Lysine degradation
- Tryptophan metabolism
- Valine, leucine and isoleucine degradation
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.35
Use Curated BLAST to search for 1.1.1.108 or 1.1.1.157 or 1.1.1.35
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7UGE9 at UniProt or InterPro
Protein Sequence (321 amino acids)
>PS417_26285 3-hydroxybutyryl-CoA dehydrogenase (Pseudomonas simiae WCS417) MRFITEIKTFAALGSGVIGSGWVSRALAHGLDVIAWDPAPGAEAALRKRVANAWGALEKQ GLAPGASQDRLRFVATIEECVKDADFIQESAPERLELKLDLHSKISAAAKPNALIGSSTS GLLPSEFYEGSTHPERCVVGHPFNPVYLLPLVEVVGGKNTALEAVQAAIKVYESLGMRPL HVRKEVPGFIADRLLEALWREALHLVNDGVATTGEIDDAIRFGAGLRWSFMGTFLTYTLA GGDAGMRHFMAQFGPALQLPWTYLPAPELTDKLIDDVVDGTSDQLGKHSISALERYRDDC LLAVLEAVKTTKAKHGMTFAE