Protein Info for GFF513 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 693 transmembrane" amino acids 12 to 27 (16 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 316 to 336 (21 residues), see Phobius details amino acids 357 to 374 (18 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 8 to 331 (324 residues), 95.1 bits, see alignment E=4.6e-31 PF19040: SGNH" amino acids 417 to 663 (247 residues), 148.1 bits, see alignment E=3.9e-47

Best Hits

Predicted SEED Role

"O-antigen acetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (693 amino acids)

>GFF513 hypothetical protein (Xanthobacter sp. DMC5)
MNLKYRPDIDGLRAVAVVVALLFHAHIPPFRGGFIGVDIFFVLSGYLITSILYNDMMKGE
FSLVDFYDRRIRRIFPALFVVLPVTTLIAAYLLMPRQMVLFAQSIIPSALFYANIHFEGL
MNYFGPKADETPLLHLWSLAVEEQYYIFFPLLMFAFLKVGGRITLGPRRMAILGFLIIAV
VSGVYAEMTARSQPTASFFLLQSRAWELLVGALLALVHMPKVSEKAANWIGVAGLLAIVI
PVFAYNYNMTFPGLSAAPIVFGTAAVIYAGTINPAGYANFLLSRPKVVYVGRISYALYLW
HWPLLVFGKTYMGRALTYFEAGGMLVVAFIFASLSLKYVETPLRHAGSLGGKRRARFAAG
IMAMAMMLSAGVLFERIGGGFFPISPLGARAEAATEDKSPFSRTCNNSPKNWSPDDLYPA
SACSVGPGAAKGEYDVVVWGDSHAGASFIGIAEQVAALGHTARLQTMAGCPPLIGGQANR
DDMPSWICTAFNAEVLREIRRVKPKVVVLVGRWAMWTTKAGPAFTLTSDEVPGGNVRSKA
VSQKVFAHMLDRTMKELSGLGIRVLLVGQPPEFGRSPGRCVAEREFYNRKSINCLELPSA
AVEKVVGLGNEMVATTAARFPGTVTFMPMEAFCRDGTCRAGDGEKFFYVDADHLSAAGAH
HLSQDPALRAALIKALGDGGSTSAALAPETTKD