Protein Info for PS417_26235 in Pseudomonas simiae WCS417

Annotation: (Fe-S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details PF11982: DUF3483" amino acids 4 to 220 (217 residues), 288.7 bits, see alignment E=1e-89 PF13237: Fer4_10" amino acids 243 to 330 (88 residues), 38.5 bits, see alignment E=3e-13 PF13183: Fer4_8" amino acids 243 to 332 (90 residues), 38.2 bits, see alignment E=5.8e-13 PF13534: Fer4_17" amino acids 244 to 333 (90 residues), 26.6 bits, see alignment E=2.5e-09 PF13187: Fer4_9" amino acids 244 to 331 (88 residues), 35.9 bits, see alignment E=2.1e-12 PF02754: CCG" amino acids 406 to 477 (72 residues), 13.8 bits, see alignment E=1.9e-05 amino acids 521 to 607 (87 residues), 56.3 bits, see alignment E=1e-18

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU5663)

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UGE5 at UniProt or InterPro

Protein Sequence (646 amino acids)

>PS417_26235 (Fe-S)-binding protein (Pseudomonas simiae WCS417)
MLNTLLPILLFAALGLAVLGALRRVNMWRRGRASKVNLLGGLLAMPKRYMVDLHHVVARD
KYIANTHVATALGFVLSALLAILVHGFGLQNRILGYALLLASVLMFVGATFVYLRRRNPP
SRLSKGPWMRLPKSLMAFSVSFFLVTLPVAGILPVDFGGWLLAALLSVGVLWGVSEMFFG
MTWGGPMKHAFAGALHLAWHRRAERFGGGRSTGLKPLDLSDKSAPLGVEKPKDFTWNQLL
GFDACVQCGKCEAACPAFAAGQPLNPKKLIQDMVVGLAGGTDAKFAGSPYPGKPIGEHSG
NPHQPIVNGLVDAETLWSCTTCRACVEECPMMIEHVDAIVDMRRHLTLEKGATPNKGAEV
LENLIATDNPGGFAPGGRLNWAADLNLPLLSEKGSCDLLFWVGDGAFDMRNQRTLRAFVK
VLKAAQIDFAVLGLEERDSGDVARRLGDEATFQLLATRNIQTLAKYSFKRIVTCDPHSFH
VLKNEYGAFNGHYRVQHHSTFMAQLIDEGALNLGQHKGSSVTYHDPCYLGRYNGEYEAPR
QVLRALGIEVKEMQRSGFRSRCCGGGGGAPITDIPGKQRIPDMRMEDIRETGAELVAVGC
PQCTAMLEGVVEPRPLIKDIAELVADALLEEAPANVPSKREPAEVH