Protein Info for GFF5119 in Sphingobium sp. HT1-2

Annotation: Putative transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 71 to 94 (24 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 152 to 179 (28 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 267 to 291 (25 residues), see Phobius details PF01226: Form_Nir_trans" amino acids 56 to 291 (236 residues), 137.7 bits, see alignment E=2.1e-44

Best Hits

KEGG orthology group: None (inferred from 57% identity to avi:Avi_5413)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>GFF5119 Putative transport (Sphingobium sp. HT1-2)
VPDSKDRKEATGPGVVSTDRGMEQMKDGKDSPHPDLDAEEAAHVEERSTGSAKVVHEVVR
LQGEEELDRPILALMLSGLAAGLAITLSLMSELFLRARLPDTDWAPLIYLLGYPVGYLIV
IMGRLQLFTESTVTAVLPVATRPSLSNLGRLARLWACVLAGNLVGVTLVSALMAGEIIIT
HEQRIVALDILAKLEWQDWSKTLMLGIPAGFIMAAIAWALPNAKGSEFWVIFLLTYVIGL
GGFSHVVTGSSQISFLWLSGEVSFQQAWFGFSLPTLIGNIIGGSGLFAVLAHGQMRSDLT
EGG