Protein Info for GFF5117 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 transmembrane" amino acids 104 to 127 (24 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 166 to 190 (25 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 260 to 278 (19 residues), see Phobius details amino acids 284 to 285 (2 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 332 to 491 (160 residues), 122.3 bits, see alignment E=8.2e-40 PF00990: GGDEF" amino acids 334 to 489 (156 residues), 115.5 bits, see alignment E=1.1e-37

Best Hits

KEGG orthology group: None (inferred from 53% identity to sal:Sala_0023)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (509 amino acids)

>GFF5117 hypothetical protein (Sphingobium sp. HT1-2)
LWLHATLPQGSRDHEDLSLIIHSSRFDRLVVRFIYRDGAVEQQHVRSGNFGTYWRAGGQL
AFRAPYRDVPVVAFTLRFDKVASAHLLRIRLVERGEEATQTTGLATLTGAALVLLIVGAI
YNASLGLAVRQQHAGWQAAWAFCMVIWGACWSQLHLFFFPSMAGAVSAQICTGLSCLAIT
LATLSAVTALEKQLLDAGLRRTALGLTASVCALGIPLSLMRSGPFDMLGNLLGFLVLANL
TAVASCIGQAWRRGSSAAQSLGGAWALPMTVLASTNFFDADAMFWGGGSQILVLFAAAWQ
TLWLSAAASRAHARLRMERDFARLAEAKAHELARRDVLTGLPNRRGFTERAGGMLEGLPA
SGALVALLLIDVDWFKSINDVYGHEAGDHVLAAIGRCIARHENSSCAVCRLGGEEFAMMI
TGAEIGNIEQFAKTLRRTLANLSHGDIIGNRMVTVSIGVTASASRVDFGTLYRLADEALY
DAKRGGRDQIAIRLSEWAGARRNDRPLFA