Protein Info for GFF511 in Pseudomonas sp. DMC3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 957 transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 97 to 122 (26 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 304 to 400 (97 residues), 26 bits, see alignment E=8.7e-10 amino acids 399 to 523 (125 residues), 56.8 bits, see alignment E=2.5e-19 PF08447: PAS_3" amino acids 304 to 387 (84 residues), 68.2 bits, see alignment E=2.3e-22 amino acids 425 to 509 (85 residues), 31.8 bits, see alignment E=5e-11 PF13188: PAS_8" amino acids 406 to 450 (45 residues), 27.5 bits, see alignment 7.4e-10 PF00989: PAS" amino acids 407 to 512 (106 residues), 38.8 bits, see alignment E=2.8e-13 PF08448: PAS_4" amino acids 408 to 518 (111 residues), 44.1 bits, see alignment E=7.9e-15 PF13426: PAS_9" amino acids 413 to 514 (102 residues), 53 bits, see alignment E=1.3e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 525 to 687 (163 residues), 101 bits, see alignment E=5.8e-33 PF00990: GGDEF" amino acids 528 to 684 (157 residues), 134.9 bits, see alignment E=8e-43 PF00563: EAL" amino acids 705 to 940 (236 residues), 248.1 bits, see alignment E=2.8e-77

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfo:Pfl01_5643)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (957 amino acids)

>GFF511 hypothetical protein (Pseudomonas sp. DMC3)
MILSAELSGPSVDPRVIRKHYAVEMAVERTRLLYQGSLLPTLFMLINGLVCAALLWSPQR
YFVVSVWLVWLLSLVALRVIQVAAFDSAIPDRQAQPIWFRMFLLGSTMTGLTLAGAGIAL
VPADNFMQQAWVFGLIGAATLSASVAYAVSLPAFLSFTLPCLLPAIGYLFWGGDDQARGW
GWLGLILLGSLSVVAWQVNRLIDRGLLRRFQNQHLIEHLQQAQTRSEQLNQELGKEIEQR
RCAEAQLREAQVDLEDRVAQRSRELDAANQALSKSEARLALALKASELGLWDWNLQTDEV
HHTQIQELFGLAPEYVTALLRDLKPRLHPEDVPSLKFALVEHLKGRTEDYQVEYRLRHGD
GHWVWIEDRGRAVERSANGRVIRMVGTRRDISASKSLEEQQRLAATVFEAASEGIVILDP
DYALIAINQAFSRVTGYEIDDMLGRNVVELPCSRDARRHYVAIRHALEQYGSWQGELVET
RKNGELYPQWLQLNAVRDSRGNVSHIVGFFADLSARRASEERLRYLTHYDELTGLANRSL
FRERLHEAHQRVRQGGRRSLALLHINLDRFKLLNDSLGHEVADQLLQKMARRLVNALPEA
DTIARLSGDEFAVLFDAYGNLSSLARVATRLSAKLRLPLSVDGHELVVSASMGISLLPDN
AREISALVSQSNMAMQHAKHLGGNNFQFFTDSLQASTLERLQLENHLRRAIEEQQLTVFY
QPKLCLQTGRMNAAEALVRWDHPSMGQVPPADFIGLAEETGLIGPIGEFVLRQACWQACE
WQRQGLAPIRVSVNLSVHQLRQGKLVSLVRQVLEETGLAPHYLELELTESHLLDSVEHII
ATFQQLRDLGVKLAIDDFGTGYSSLSYLKRIPVDYVKIDQAFIRGLSEGSADAAITRAII
AMAHGLALKVVAEGVEREDQLAFLRAEHCDEVQGYLISRPVDAACLAGLLRDQKNPQ