Protein Info for PS417_26175 in Pseudomonas simiae WCS417

Annotation: sarcosine oxidase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01375: sarcosine oxidase, gamma subunit family
  • amino acids 52 to 203 (152 residues), 172.2 bits, E=3.4e-55
• PF04268: SoxG
  • amino acids 53 to 203 (151 residues), 261.3 bits, E=2.9e-82
• PF01571: GCV_T
  • amino acids 84 to 206 (123 residues), 36.4 bits, E=3.6e-13

Best Hits

KEGG orthology group: K00305, sarcosine oxidase, subunit gamma [EC: 1.5.3.1] (inferred from 98% identity to pfs:PFLU5648)

Predicted SEED Role

"Sarcosine oxidase gamma subunit (EC 1.5.3.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 1.5.3.1)

MetaCyc Pathways

• glycine betaine degradation I (6/8 steps found)
• creatinine degradation I (2/4 steps found)
• creatinine degradation II (2/5 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.5.3.1

Use Curated BLAST to search for 1.5.3.1

Sequence Analysis Tools

See A0A1N7UA86 at UniProt or InterPro

Protein Sequence (210 amino acids)

>PS417_26175 sarcosine oxidase subunit gamma (Pseudomonas simiae WCS417)
MTAANVYQQRPTTGAKAESSLHHADLASLVGKGRKNAGVTVREKKLLGHLTLRGDGHDAA
FAAGVHKALGIELPGALQVIVKGETSLQWLGPDEWLLIVPSGEEFAAEQNLRAALGDLHI
QIVNVSGGQQILELSGPNVRDVLMKSTSYDVHPNNFPVGKAVGTVFAKSQLVIRHTAEDT
WELLIRRSFSDYWWLWLQDASAEFGLSVQA