Protein Info for PS417_26165 in Pseudomonas simiae WCS417

Annotation: aldehyde dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02819: formaldehyde dehydrogenase, glutathione-independent
  • amino acids 2 to 395 (394 residues), 769 bits, E=3.7e-236
• PF08240: ADH_N
  • amino acids 35 to 145 (111 residues), 97.7 bits, E=1.8e-32

Best Hits

Swiss-Prot: 94% identical to FADH_PSEPU: Glutathione-independent formaldehyde dehydrogenase (fdhA) from Pseudomonas putida

KEGG orthology group: K00148, glutathione-independent formaldehyde dehydrogenase [EC: 1.2.1.46] (inferred from 98% identity to pfs:PFLU5646)

Predicted SEED Role

"Threonine dehydrogenase and related Zn-dependent dehydrogenases" in subsystem Threonine degradation

MetaCyc Pathways

• formaldehyde oxidation IV (thiol-independent) (1/1 steps found)
• methanol oxidation to carbon dioxide (3/6 steps found)
• superpathway of C1 compounds oxidation to CO₂ (5/12 steps found)

KEGG Metabolic Maps

• Methane metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.46

Sequence Analysis Tools

See A0A1N7U2G5 at UniProt or InterPro

Protein Sequence (399 amino acids)

>PS417_26165 aldehyde dismutase (Pseudomonas simiae WCS417)
MSGNRGVVYLGSGKVEVQKIDYPKMQDPRGRKIEHGVILRVVSTNICGSDQHMVRGRTTA
QTGLVLGHEITGEVIEKGSDVENLKIGDLVSVPFNVACGRCRSCKEQHTGVCLTVNPARA
GGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPDRDKAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYIAGAGPVGLAAAASARLLGAAVVIIGDVNSIRLAHAKGQGFEVVDLSTD
TPLHEQIAALLGEPEVDCAVDCVGFEARGHGHDGVKAEAPATVLNSLMGVVRVAGKIGIP
GLYVTEDPGAVDAAAKMGSLSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRINIA
EIVGVQVISLDDAPRGYGEFDAGVPKKFVIDPHKLFSAA