Protein Info for GFF5106 in Variovorax sp. SCN45

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 84 to 107 (24 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details PF00892: EamA" amino acids 26 to 155 (130 residues), 52.1 bits, see alignment E=4.4e-18 amino acids 166 to 307 (142 residues), 55.8 bits, see alignment E=3e-19

Best Hits

KEGG orthology group: None (inferred from 87% identity to vpe:Varpa_0236)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>GFF5106 Permease of the drug/metabolite transporter (DMT) superfamily (Variovorax sp. SCN45)
MDSKQGNGTAAWGGPGARKRAGIGLAEVMLLLVAAVWGGSYAVAKQATQQLPVLEFIALR
FGLTFVVLLPALGPLFGARWRQGLAVGGLLGANLLAIFVCETFGVSLTSASNAAFLISLC
VAITPFVEWWLLGQRPARRVFWAAGLSALGAAMLSAASPTDLSLGWGDGLMVAAAFLRAV
MVCMTRRLAGRHALPALTLTALQSGVMALGAAAISLVASPPNGAWHMPPATASFWWGMAY
LVLLCTVFAFFAQNHAASRSSPSRVSLLMGSEPVFGALIAVYGFGERIGPWGWAGGLLIV
AAAWWVTMPRADGR