Protein Info for PS417_26130 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 307 to 327 (21 residues), see Phobius details amino acids 335 to 354 (20 residues), see Phobius details amino acids 360 to 379 (20 residues), see Phobius details amino acids 386 to 407 (22 residues), see Phobius details amino acids 412 to 432 (21 residues), see Phobius details PF06123: CreD" amino acids 5 to 438 (434 residues), 548.9 bits, see alignment E=4.2e-169

Best Hits

KEGG orthology group: K06143, inner membrane protein (inferred from 94% identity to pfs:PFLU5639)

Predicted SEED Role

"Inner membrane protein CreD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UPT4 at UniProt or InterPro

Protein Sequence (457 amino acids)

>PS417_26130 membrane protein (Pseudomonas simiae WCS417)
MNRSLLFKLGAIALLMLLLLIPLLMINGIIADRQFTRDNVLDDIARSSSYSQRLTGPVMV
VPYRKTVREWKLNEKLNKRYEVTREERGRLYFLPDRFELDGKVQTELRARGIYQARLFHA
DNRISGRFELPAQLGIAENFADYRFEPAFLAVGISDIRGIENALKLELGSQQLEFEPGSQ
VDWLGEGVHVTLPEQDSKKPNVVDFAFDLRLQGTEQLQVVPVGKTSQVSLASNWPHPSFI
GNFLPAQREITDTGFTANWQTSFFSTNLEQALQTCLDKQGCDDFNNRSFGVNFIDPVDQY
LKSDRAIKYALLFIALTFAGFFLFEVLKSLAVHPIQYALVGFALAFFYLLLLSLSEHIGF
ALAYLISASACVLLIGFYVCHVLRSIIHGLGFSAGLAALYGLLYGLLSAEDYALLMGSLL
LFGLLGTVMVLTRKLDWYGVGKRKAAEPLAFDLEAVQ