Protein Info for PS417_26060 in Pseudomonas simiae WCS417

Annotation: DNA polymerase III subunit epsilon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 PF00929: RNase_T" amino acids 42 to 200 (159 residues), 37.6 bits, see alignment E=1.6e-13

Best Hits

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 92% identity to pfs:PFLU5626)

Predicted SEED Role

"DNA polymerase III epsilon subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1T846 at UniProt or InterPro

Protein Sequence (235 amino acids)

>PS417_26060 DNA polymerase III subunit epsilon (Pseudomonas simiae WCS417)
MSLFNWLRKKKPGLDSAQQQRLAQLRSPTPLGNNTLRNQRWVVVDLETSGLNLNRDQVLS
IGAVVIEDGAVDFSQLFERTLQRAETKLSPSVLIHGLGPSAIAAGSDPVDALLDFMDFVG
DSPLLAFHAPFDQHMLCRALKDSLGYRLTHPFLDVADIAPLLCPEAHIREAGLDDWINHF
NLHVGERHHASADALATAELMLILFSRARQQHIDTPQVLQERLSQWKRRQHAPSF