Protein Info for PS417_26055 in Pseudomonas simiae WCS417

Annotation: cyclic nucleotide-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 640 PF00027: cNMP_binding" amino acids 50 to 133 (84 residues), 33.4 bits, see alignment E=7e-12 PF00571: CBS" amino acids 176 to 230 (55 residues), 39.6 bits, see alignment 1.1e-13 amino acids 244 to 291 (48 residues), 32.6 bits, see alignment 1.7e-11 PF03445: DUF294" amino acids 319 to 458 (140 residues), 142.7 bits, see alignment E=1.4e-45 PF10335: DUF294_C" amino acids 495 to 638 (144 residues), 148.8 bits, see alignment E=2e-47

Best Hits

KEGG orthology group: K07182, CBS domain-containing protein (inferred from 96% identity to pfs:PFLU5625)

Predicted SEED Role

"Predicted signal-transduction protein containing cAMP-binding and CBS domains" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TPE0 at UniProt or InterPro

Protein Sequence (640 amino acids)

>PS417_26055 cyclic nucleotide-binding protein (Pseudomonas simiae WCS417)
MSKADAFAQAGKTAVLQNIHGTLQFLQRFPPFNQMENAHLAFLVEQCQLRFYGPGDSILK
PSGGPVEHFYIVKQGRVVGERPDSAETTFEITTGECFPLAALLGERATRTEHKAAEDTFC
LQLNKPAFIKLFALSSPFRDFALRGVSSLLDQVNQQVQQKAVETLGTQYSLNTRLGELAM
RHPVTCSPATPLREAVTLMHEQQVGSIVIVDELKAPLGIFTLRDLRQVVADGTSDFSQPI
EGHMTQAPFFLTPDHSAFDAAIAMTERHIAHVCLVKDQRLCGVVSERDLFSLQRVDLVHL
ARTIRNAPRVDNLVAIRGEIGQLVERMLAHGASSTQITHIITLLNDHTVCRVIELTLAEK
GDPGVPFSWLCFGSEGRREQTLYTDQDNGILFDAKDAAEAAAIRGRLLPLAQQINQSLAL
CGFSLCKGNIMAGNPELCLSRAEWARRFAAFIREATPENLLGSSIYFDLRVVWGDERGCE
QLRQTILDQVADNRLFQRMLAENALRQRPPVGRFREFVLTRKGGEKATLDLKVQGLTPFV
DGARLLALANGIHANNTLERLRQLVVKEVIEPLDGAAYEEAYHFIQQTRMQQHQLQSREN
QPYSNRVDPDSLNHLDRRILRESLRQAQRLQSSLTLRYQL