Protein Info for GFF5086 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Trans-aconitate 2-methyltransferase (EC 2.1.1.144)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF13489: Methyltransf_23" amino acids 13 to 145 (133 residues), 44.6 bits, see alignment E=4.8e-15 PF05175: MTS" amino acids 22 to 99 (78 residues), 25.3 bits, see alignment E=3.6e-09 PF01728: FtsJ" amino acids 31 to 99 (69 residues), 25.1 bits, see alignment E=5.3e-09 PF13847: Methyltransf_31" amino acids 34 to 142 (109 residues), 61.1 bits, see alignment E=3.7e-20 PF13649: Methyltransf_25" amino acids 35 to 123 (89 residues), 62.8 bits, see alignment E=1.4e-20 PF08242: Methyltransf_12" amino acids 35 to 125 (91 residues), 57.5 bits, see alignment E=6.9e-19 PF08241: Methyltransf_11" amino acids 36 to 126 (91 residues), 54.4 bits, see alignment E=5.6e-18

Best Hits

Swiss-Prot: 52% identical to TAM_RHILO: Trans-aconitate 2-methyltransferase (tam) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K00598, trans-aconitate 2-methyltransferase [EC: 2.1.1.144] (inferred from 78% identity to del:DelCs14_3311)

Predicted SEED Role

"Trans-aconitate 2-methyltransferase (EC 2.1.1.144)" (EC 2.1.1.144)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.144

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>GFF5086 Trans-aconitate 2-methyltransferase (EC 2.1.1.144) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTWSARTYSVFEQERTRPVRDLVAALPARDVQVAIDLGCGPGNSTEVLADRFPQARVTGL
DSSEDMLAAARERLPGTRFELGDIGTWNPVESFDVILANASLQWLPDHAALYPRLVSRLA
AGGSLAVQTPDNLEEPAHRLAREVAAQGPWAGKIAGVQHPARHGAAFYYALLKPHCTAVD
VWRTTYHHPLAGGPEAVVEWFKGSALRPYLAPLDDGEKAAFLARYLAAITQAYPALADGT
VLLPFPRLFIVASR