Protein Info for GFF5082 in Variovorax sp. SCN45

Annotation: Uncharacterized MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 32 to 60 (29 residues), see Phobius details amino acids 67 to 91 (25 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 131 to 157 (27 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 205 to 222 (18 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 344 to 369 (26 residues), see Phobius details amino acids 381 to 405 (25 residues), see Phobius details amino acids 412 to 431 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 35 to 229 (195 residues), 63.1 bits, see alignment E=2.4e-21 amino acids 236 to 423 (188 residues), 39 bits, see alignment E=4.8e-14 PF07690: MFS_1" amino acids 37 to 387 (351 residues), 78 bits, see alignment E=6.5e-26

Best Hits

KEGG orthology group: None (inferred from 83% identity to vpe:Varpa_0256)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>GFF5082 Uncharacterized MFS-type transporter (Variovorax sp. SCN45)
MSEAALPASPIRGSSPTATAQGKGKQSQFRLIAACSLGNALEMYDFTVYSFFALLIGKLF
FPSDSPYGSLLLAVATFGIGFVMRPLGGVIIGNYADRKGRKAAMTLTIGLMVLGTLCIAL
APSYASAGVFGSLMIVAGRLLQGFSLGGEVGAATSMLMEAGGVKGRGFRVSWQLASQGVS
ALLGALTGAALYAALPQASLESWGWRLPFLLGLLIAPVGLYIRSQLEETHVAESHESSPI
GRLLRNHGGLVLKGILATTAGTATMYLVVFFMPTYMIRVLHMPPSLSLLSGCVTGITLFL
VSLVAGRLADRLPARKPLVIGSLLFSVVAVYPAFWLISHYPSVPLVLGLSALLTASVNIG
TTPMFLMLLEMLPTGVRASGISVVYSIGVTVFGGSSQFIVTWLLASTGNPMSPAFYMMAC
GLLSLGALLSLREHKAD