Protein Info for GFF508 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details transmembrane" amino acids 45 to 45 (1 residues), see Phobius details amino acids 50 to 84 (35 residues), see Phobius details amino acids 93 to 117 (25 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 230 to 256 (27 residues), see Phobius details amino acids 268 to 296 (29 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 41 to 314 (274 residues), 120.5 bits, see alignment E=3.9e-39

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 99% identity to vpe:Varpa_3439)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>GFF508 ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MFLKRLLSNDMPRSRLLALLLVVLFLALAFAPFIFPGVKALSVAAKILVFVVLVASFDLL
LGYTGIVSFAHTMFFGIGAYGIAISASRLGPNWGAVLVGLGASLAISLVLSFAIGLFSLR
VRAIFFAMITLAVASAFQTLASQLSDFTGGEDGLTFKLPELISPSFEFSEEPFLGVSLDG
RLLCYYLLFVAAVVLVLALLRIVNSPFGRVLQAIRENEFRAEAIGYRVVVYRTTAAVLSA
LFATLAGAMLAIWLRYNGPDTSLSFEIMIDVLLIVVIGGMGTIYGAAIGAVLFVIAQSYL
QDLLRIGNEAASGLPWLAALLSPDRWLLWLGVLFVLSVYYFPTGIVGKLRARAAR