Protein Info for PS417_26015 in Pseudomonas simiae WCS417

Annotation: ModE family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 TIGR00637: ModE molybdate transport repressor domain" amino acids 15 to 101 (87 residues), 102.3 bits, see alignment E=1.3e-33 PF00126: HTH_1" amino acids 17 to 79 (63 residues), 44 bits, see alignment E=2.7e-15 TIGR00638: molybdenum-pterin binding domain" amino acids 113 to 180 (68 residues), 66.7 bits, see alignment E=1.4e-22 PF03459: TOBE" amino acids 115 to 176 (62 residues), 65.2 bits, see alignment E=7.4e-22

Best Hits

Swiss-Prot: 40% identical to MODE_AZOVI: Molybdenum transport protein ModE (modE) from Azotobacter vinelandii

KEGG orthology group: K02019, molybdate transport system regulatory protein (inferred from 90% identity to pfs:PFLU5617)

Predicted SEED Role

"DNA-binding domain of ModE / Molybdate-binding domain of ModE" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UIN6 at UniProt or InterPro

Protein Sequence (254 amino acids)

>PS417_26015 ModE family transcriptional regulator (Pseudomonas simiae WCS417)
MSLPTPLSQHIIRRPQRIALLAHIAEQGSITRAAKSAGLSYKAAWDAIDELNNLAQKPLV
ERSVGGKGGGGAKLTAEGERVLRLYQRLQVLQAQVLGSDEAASDFNLLGRLMLRTSARNQ
LHGQVVAIEQHGRNDLIRLQLAGGLTLAAQITHDSTQRLELEIGVEVVALIKAGWLELLA
PEALATTGNNCMSGIVDAILDAEDGPSEVRVILPNGQVLCALAQPDTLKALCVAEGKAIQ
VQCAPSNVLLGTPV