Protein Info for GFF5077 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: similar to ABC-type nitrate/sulfonate/bicarbonate transport systems periplasmic components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF09084: NMT1" amino acids 132 to 279 (148 residues), 24.3 bits, see alignment E=1.3e-09

Best Hits

KEGG orthology group: None (inferred from 72% identity to mno:Mnod_4885)

Predicted SEED Role

"similar to ABC-type nitrate/sulfonate/bicarbonate transport systems periplasmic components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>GFF5077 similar to ABC-type nitrate/sulfonate/bicarbonate transport systems periplasmic components (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTVVTKNRTSRNRLRALSSAAALALGLIGQAGTAAAEVLPAINLQLTPWTVIAREKGIFK
EEFSKVGTEEVNLIASGGAELVGAETGALSKGAISIAQRMIYPATVHRANGLDGVIIWAS
ETSNRYRAPVLAAVSNKSVNTLADLDGKKFGSSRISCYWSAPTEALNSVGLPLDTRQTKG
RVRYESIDNPTVAISAVISGALDATTTHLAAGNATGAWLSGKLKVIGHVPDDGVYVNHAG
RVTYFAKREFVNKYPEAVKAFLASRERAMAWTLDNVDEAAKIVSRETRVPVEVAKFQITH
LGQWEFMAGEPNAQRARNSIKTFIDWYVKQGDDILSERRLTDAQVDAFVDGRFFAGGTHS
IYR