Protein Info for PS417_25985 in Pseudomonas simiae WCS417

Annotation: dethiobiotin synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF13500: AAA_26" amino acids 4 to 213 (210 residues), 136.1 bits, see alignment E=1.5e-43 PF01656: CbiA" amino acids 6 to 210 (205 residues), 53.3 bits, see alignment E=2.8e-18 TIGR00347: dethiobiotin synthase" amino acids 6 to 177 (172 residues), 153.2 bits, see alignment E=3.6e-49

Best Hits

Swiss-Prot: 74% identical to BIOD_PSEA7: ATP-dependent dethiobiotin synthetase BioD (bioD) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K01935, dethiobiotin synthetase [EC: 6.3.3.3] (inferred from 96% identity to pfs:PFLU5611)

MetaCyc: 48% identical to dethiobiotin synthetase (Escherichia coli K-12 substr. MG1655)
Dethiobiotin synthase. [EC: 6.3.3.3]

Predicted SEED Role

"Dethiobiotin synthetase (EC 6.3.3.3)" in subsystem Biotin biosynthesis (EC 6.3.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U4S8 at UniProt or InterPro

Protein Sequence (226 amino acids)

>PS417_25985 dethiobiotin synthetase (Pseudomonas simiae WCS417)
MTAAYFITGTDTDVGKTTVAAGLLHAARQAGRSTAAGKPVASGCQVTPKGLRNADALALL
AECSLPLSYAEVNPVAFEPAIAPHLAAREAGVSLTVQSLLKPMQQMLAREADFTLIEGAG
GWRVPLADQANLSDLAMALKLPVILVVGVRLGCISHALLTAEAIARDGLQLAGWVANIID
PKTSRLEENLATLAERLPAPCLGRVPKLKHAGAEAVAEYLQLDLLD