Protein Info for PS417_25915 in Pseudomonas simiae WCS417

Annotation: carbon-nitrogen hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF00795: CN_hydrolase" amino acids 2 to 243 (242 residues), 206.3 bits, see alignment E=2.6e-65

Best Hits

Swiss-Prot: 81% identical to YPQQ_PSEPH: Hydrolase in pqqF 5'region from Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CHA0)

KEGG orthology group: None (inferred from 95% identity to pfs:PFLU5596)

MetaCyc: 63% identical to 5-aminopentanamidase (Pseudomonas putida)
5-aminopentanamidase. [EC: 3.5.1.30]

Predicted SEED Role

"5-aminopentanamidase (EC 3.5.1.30)" in subsystem Lysine degradation (EC 3.5.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UA34 at UniProt or InterPro

Protein Sequence (264 amino acids)

>PS417_25915 carbon-nitrogen hydrolase (Pseudomonas simiae WCS417)
MRVALYQCPPQPLDVSGNLKRLHALAHEASSADVLVLPEMFLTGYNIGAEAVGALAEAQD
GPSAQAIAELAKSAGLAILYGYPERAEDGQIYNAVQLIDAHGQCRCNYRKTHLFGDLDHS
MFSAGEDNFPLVELNGWTLGFLICYDLEFPENTRRLALAGAELILVPTANMVPFDFVADV
TVRARAFENQCYVAYANYCGREGEIQYCGQSSIAAPNGQRIAQAGLDEALIVGELDRQSI
LDARAANHYLQDRRPELYGALHKP